Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Pyruvate decarboxylase [52478] (3 species) rudiment domain with a variant fold, lacks FAD-binding |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52480] (2 PDB entries) |
Domain d1pvdb1: 1pvd B:182-360 [31738] Other proteins in same PDB: d1pvda2, d1pvda3, d1pvdb2, d1pvdb3 |
PDB Entry: 1pvd (more details), 2.3 Å
SCOP Domain Sequences for d1pvdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvdb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)} qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhs dhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp
Timeline for d1pvdb1: