Lineage for d1pvdb1 (1pvd B:182-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107283Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 protein domains)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2107447Protein Pyruvate decarboxylase [52478] (3 species)
    rudiment domain with a variant fold, lacks FAD-binding
  7. 2107448Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52480] (2 PDB entries)
  8. 2107450Domain d1pvdb1: 1pvd B:182-360 [31738]
    Other proteins in same PDB: d1pvda2, d1pvda3, d1pvdb2, d1pvdb3
    complexed with mg, tpp

Details for d1pvdb1

PDB Entry: 1pvd (more details), 2.3 Å

PDB Description: crystal structure of the thiamin diphosphate dependent enzyme pyruvate decarboxylase from the yeast saccharomyces cerevisiae at 2.3 angstroms resolution
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d1pvdb1:

Sequence, based on SEQRES records: (download)

>d1pvdb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Sequence, based on observed residues (ATOM records): (download)

>d1pvdb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhs
dhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

SCOPe Domain Coordinates for d1pvdb1:

Click to download the PDB-style file with coordinates for d1pvdb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvdb1: