Lineage for d5j34d_ (5j34 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155664Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2155665Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2155666Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2155825Protein automated matches [190072] (19 species)
    not a true protein
  7. 2155937Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256054] (2 PDB entries)
  8. 2155945Domain d5j34d_: 5j34 D: [317363]
    automated match to d3u1hb_
    complexed with mg, so4; mutant

Details for d5j34d_

PDB Entry: 5j34 (more details), 1.83 Å

PDB Description: isopropylmalate dehydrogenase k232m mutant
PDB Compounds: (D:) 3-isopropylmalate dehydrogenase 2, chloroplastic

SCOPe Domain Sequences for d5j34d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j34d_ c.77.1.1 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
rkrrgklcsvdmanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds

SCOPe Domain Coordinates for d5j34d_:

Click to download the PDB-style file with coordinates for d5j34d_.
(The format of our PDB-style files is described here.)

Timeline for d5j34d_: