Lineage for d1gsh_1 (1gsh 1-122)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69114Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 69115Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 69212Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein)
  6. 69213Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species)
  7. 69214Species Escherichia coli [TaxId:562] [52459] (4 PDB entries)
  8. 69216Domain d1gsh_1: 1gsh 1-122 [31719]
    Other proteins in same PDB: d1gsh_2

Details for d1gsh_1

PDB Entry: 1gsh (more details), 2 Å

PDB Description: structure of escherichia coli glutathione synthetase at ph 7.5

SCOP Domain Sequences for d1gsh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsh_1 c.30.1.3 (1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc

SCOP Domain Coordinates for d1gsh_1:

Click to download the PDB-style file with coordinates for d1gsh_1.
(The format of our PDB-style files is described here.)

Timeline for d1gsh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsh_2