![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein) automatically mapped to Pfam PF02951 |
![]() | Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52459] (4 PDB entries) |
![]() | Domain d1gsha1: 1gsh A:1-122 [31719] Other proteins in same PDB: d1gsha2 |
PDB Entry: 1gsh (more details), 2 Å
SCOPe Domain Sequences for d1gsha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsha1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr dc
Timeline for d1gsha1: