Lineage for d5b1wc1 (5b1w C:106-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002655Domain d5b1wc1: 5b1w C:106-232 [317179]
    Other proteins in same PDB: d5b1wa2, d5b1wb2, d5b1wc2, d5b1wd2
    automated match to d1b6ea_
    complexed with ca

Details for d5b1wc1

PDB Entry: 5b1w (more details), 3.05 Å

PDB Description: crystal structure of human dendritic cell inhibitory receptor (dcir) c-type lectin domain in ligand-free form
PDB Compounds: (C:) C-type lectin domain family 4 member A

SCOPe Domain Sequences for d5b1wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1wc1 d.169.1.0 (C:106-232) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayfv
glsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclgp
qrsvcem

SCOPe Domain Coordinates for d5b1wc1:

Click to download the PDB-style file with coordinates for d5b1wc1.
(The format of our PDB-style files is described here.)

Timeline for d5b1wc1: