SCOPe 2.06: Domain d5b1wc1: 5b1w C:106-232

Lineage for d5b1wc1 (5b1w C:106-232)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d5b1wc1: 5b1w C:106-232 [317179]
   Other proteins in same PDB: d5b1wa2, d5b1wb2, d5b1wc2, d5b1wd2
   automated match to d1b6ea_
   complexed with ca

Details for d5b1wc1

PDB Entry: 5b1w, 3.05 Å

PDB Description: crystal structure of human dendritic cell inhibitory receptor (dcir) c-type lectin domain in ligand-free form

PDB Compounds: (C:) C-type lectin domain family 4 member A

SCOPe Domain Sequences for d5b1wc1:

Sequence; same for both SEQRES and ATOM records:

>d5b1wc1 d.169.1.0 (C:106-232) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayfv
glsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclgp
qrsvcem

Timeline for d5b1wc1:

• d5b1wc1 is new in SCOPe 2.06-stable
  
• d5b1wc1 appears in SCOPe 2.07
  
• d5b1wc1 appears in the current release, SCOPe 2.08