Lineage for d5a0yf_ (5a0y F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197886Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2197887Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2197888Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries)
  8. 2197890Domain d5a0yf_: 5a0y F: [317174]
    Other proteins in same PDB: d5a0ya1, d5a0ya2, d5a0yb1, d5a0yb2, d5a0yd1, d5a0yd2, d5a0ye1, d5a0ye2
    automated match to d1hbnc_
    complexed with cl, com, f43, k, mg, na, tp7

Details for d5a0yf_

PDB Entry: 5a0y (more details), 1.1 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter marburgensis at 1.1 a resolution
PDB Compounds: (F:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d5a0yf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a0yf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnle

SCOPe Domain Coordinates for d5a0yf_:

Click to download the PDB-style file with coordinates for d5a0yf_.
(The format of our PDB-style files is described here.)

Timeline for d5a0yf_: