SCOPe 2.08: Domain d1iova1: 1iov A:1-96

Lineage for d1iova1 (1iov A:1-96)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species)

7. Species Escherichia coli, gene ddlB [TaxId:562] [52454] (3 PDB entries)

8. Domain d1iova1: 1iov A:1-96 [31714]
   Other proteins in same PDB: d1iova2
   complexed with adp, mg, pob

Details for d1iova1

PDB Entry: 1iov, 2.2 Å

PDB Description: complex of d-ala:d-ala ligase with adp and a phosphoryl phosphonate

PDB Compounds: (A:) d-ala:d-ala ligase

SCOPe Domain Sequences for d1iova1:

Sequence; same for both SEQRES and ATOM records:

>d1iova1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd

Timeline for d1iova1:

• d1iova1 first appeared (with stable ids) in SCOP 1.55, called d1iov_1
  
• d1iova1 appears in SCOPe 2.07