Lineage for d5eola_ (5eol A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220589Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 2220590Species Human (Homo sapiens) [TaxId:9606] [118134] (99 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 2220675Domain d5eola_: 5eol A: [317001]
    automated match to d4k0ya_
    complexed with 5qo, gol

Details for d5eola_

PDB Entry: 5eol (more details), 2.2 Å

PDB Description: crystal structure of human pim-1 kinase in complex with a macrocyclic quinoxaline-pyrrolodihydropiperidinone inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d5eola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eola_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

SCOPe Domain Coordinates for d5eola_:

Click to download the PDB-style file with coordinates for d5eola_.
(The format of our PDB-style files is described here.)

Timeline for d5eola_: