Lineage for d5fkla2 (5fkl A:68-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341268Protein automated matches [226970] (6 species)
    not a true protein
  7. 2341285Species Escherichia coli [TaxId:562] [226229] (9 PDB entries)
  8. 2341295Domain d5fkla2: 5fkl A:68-208 [316656]
    Other proteins in same PDB: d5fkla1, d5fkla3
    automated match to d2xpwa2
    complexed with cl, mg, so4, tdc; mutant

Details for d5fkla2

PDB Entry: 5fkl (more details), 1.9 Å

PDB Description: tetr(d) h100a mutant in complex with anhydrotetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor, class d

SCOPe Domain Sequences for d5fkla2:

Sequence, based on SEQRES records: (download)

>d5fkla2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d5fkla2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpenlppllrealqimdsddgeqaflhgle
slirgfevqltallqiv

SCOPe Domain Coordinates for d5fkla2:

Click to download the PDB-style file with coordinates for d5fkla2.
(The format of our PDB-style files is described here.)

Timeline for d5fkla2: