Lineage for d5enca1 (5enc A:1315-1436)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320743Domain d5enca1: 5enc A:1315-1436 [316651]
    Other proteins in same PDB: d5enca2
    automated match to d3mb3a_
    complexed with 5qd, edo

Details for d5enca1

PDB Entry: 5enc (more details), 1.59 Å

PDB Description: crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with n-(2,6- dichlorobenzyl)acetamide (sgc - diamond i04-1 fragment screening)
PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5enca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5enca1 a.29.2.0 (A:1315-1436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagn
yespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr
nt

SCOPe Domain Coordinates for d5enca1:

Click to download the PDB-style file with coordinates for d5enca1.
(The format of our PDB-style files is described here.)

Timeline for d5enca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5enca2