| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [52443] (7 PDB entries) |
| Domain d1dv1b2: 1dv1 B:1-114 [31642] Other proteins in same PDB: d1dv1a1, d1dv1a3, d1dv1b1, d1dv1b3 complexed with po4 |
PDB Entry: 1dv1 (more details), 1.9 Å
SCOPe Domain Sequences for d1dv1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv1b2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d1dv1b2: