SCOP 1.73: Domain d1mjha_: 1mjh A:

Lineage for d1mjha_ (1mjh A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (6 proteins)
   Pfam PF00582

6. Protein "Hypothetical" protein MJ0577 [52437] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)

8. Domain d1mjha_: 1mjh A: [31639]

Details for d1mjha_

PDB Entry: 1mjh, 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics

PDB Compounds: (A:) protein (ATP-binding domain of protein mj0577)

SCOP Domain Sequences for d1mjha_:

Sequence, based on SEQRES records:

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records):

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte
eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill
gsvtenvikksnkpvlvvkrkns

Timeline for d1mjha_:

• d1mjha_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjha_ appears in SCOP 1.71
  
• d1mjha_ appears in SCOP 1.75
  
• d1mjha_ appears in the current release, SCOPe 2.08