SCOPe 2.07: Domain d4y24a_: 4y24 A:

Lineage for d4y24a_ (4y24 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
   Uniprot P09382

8. Domain d4y24a_: 4y24 A: [316365]
   automated match to d4q27b_
   complexed with td2

Details for d4y24a_

PDB Entry: 4y24, 2.32 Å

PDB Description: complex of human galectin-1 and td-139

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d4y24a_:

Sequence; same for both SEQRES and ATOM records:

>d4y24a_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

Timeline for d4y24a_:

• d4y24a_ first appeared in SCOPe 2.06
  
• d4y24a_ appears in the current release, SCOPe 2.08