| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
| Species Human (Homo sapiens) [TaxId:9606] [81390] (3 PDB entries) Uniprot P38117 |
| Domain d1efvb_: 1efv B: [31634] Other proteins in same PDB: d1efva1, d1efva2 complexed with amp, fad |
PDB Entry: 1efv (more details), 2.1 Å
SCOPe Domain Sequences for d1efvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
dlvaklkeigri
Timeline for d1efvb_: