Lineage for d5dbmb_ (5dbm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2319940Protein CREB-binding protein, CBP [74712] (1 species)
  7. 2319941Species Human (Homo sapiens) [TaxId:9606] [74713] (37 PDB entries)
  8. 2319989Domain d5dbmb_: 5dbm B: [316075]
    Other proteins in same PDB: d5dbmc2
    automated match to d4nyxa_
    complexed with 58n

Details for d5dbmb_

PDB Entry: 5dbm (more details), 1.86 Å

PDB Description: crystal structure of the cbp bromodomain in complex with cpi703
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d5dbmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dbmb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d5dbmb_:

Click to download the PDB-style file with coordinates for d5dbmb_.
(The format of our PDB-style files is described here.)

Timeline for d5dbmb_: