SCOP 1.65: Domain d1f9ad_: 1f9a D:

Lineage for d1f9ad_ (1f9a D:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (4 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52401] (1 PDB entry)

8. Domain d1f9ad_: 1f9a D: [31605]

Details for d1f9ad_

PDB Entry: 1f9a, 2 Å

PDB Description: crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii

SCOP Domain Sequences for d1f9ad_:

Sequence; same for both SEQRES and ATOM records:

>d1f9ad_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii}
lrgfiigrfqpfhkghlevikkiaeevdeiiigigsaqkshtlenpftagerilmitqsl
kdydltyypipikdiefnsiwvsyvesltppfdivysgnplvrvlfeergyevkrpemfn
rkeysgteirrrmlngekwehlvpkavvdvikeikgverlrkla

Timeline for d1f9ad_:

• d1f9ad_ first appeared (with stable ids) in SCOP 1.55
  
• d1f9ad_ appears in SCOP 1.63
  
• d1f9ad_ appears in SCOP 1.67
  
• d1f9ad_ appears in the current release, SCOPe 2.08