Lineage for d1f9ad_ (1f9a D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860402Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2860469Species Methanococcus jannaschii [TaxId:2190] [52401] (1 PDB entry)
  8. 2860473Domain d1f9ad_: 1f9a D: [31605]
    complexed with atp, mg

Details for d1f9ad_

PDB Entry: 1f9a (more details), 2 Å

PDB Description: crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
PDB Compounds: (D:) hypothetical protein mj0541

SCOPe Domain Sequences for d1f9ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ad_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanococcus jannaschii [TaxId: 2190]}
lrgfiigrfqpfhkghlevikkiaeevdeiiigigsaqkshtlenpftagerilmitqsl
kdydltyypipikdiefnsiwvsyvesltppfdivysgnplvrvlfeergyevkrpemfn
rkeysgteirrrmlngekwehlvpkavvdvikeikgverlrkla

SCOPe Domain Coordinates for d1f9ad_:

Click to download the PDB-style file with coordinates for d1f9ad_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ad_: