Lineage for d1euya2 (1euy A:8-338)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242044Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (11 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 242062Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (1 species)
  7. 242063Species Escherichia coli [TaxId:562] [52381] (11 PDB entries)
  8. 242068Domain d1euya2: 1euy A:8-338 [31584]
    Other proteins in same PDB: d1euya1
    protein/tRNA complex; complexed with qsi; mutant

Details for d1euya2

PDB Entry: 1euy (more details), 2.6 Å

PDB Description: glutaminyl-trna synthetase complexed with a trna mutant and an active site inhibitor

SCOP Domain Sequences for d1euya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euya2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

SCOP Domain Coordinates for d1euya2:

Click to download the PDB-style file with coordinates for d1euya2.
(The format of our PDB-style files is described here.)

Timeline for d1euya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1euya1