Lineage for d1d2re_ (1d2r E:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482380Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 482456Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 482457Species Bacillus stearothermophilus [TaxId:1422] [52379] (8 PDB entries)
  8. 482473Domain d1d2re_: 1d2r E: [31576]

Details for d1d2re_

PDB Entry: 1d2r (more details), 2.9 Å

PDB Description: 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site.

SCOP Domain Sequences for d1d2re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2re_ c.26.1.1 (E:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1d2re_:

Click to download the PDB-style file with coordinates for d1d2re_.
(The format of our PDB-style files is described here.)

Timeline for d1d2re_: