Lineage for d5ilwa_ (5ilw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606087Protein automated matches [190420] (9 species)
    not a true protein
  7. 2606125Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 2606242Domain d5ilwa_: 5ilw A: [315135]
    automated match to d4dwma_
    complexed with gol, nag, uri

Details for d5ilwa_

PDB Entry: 5ilw (more details), 1.98 Å

PDB Description: crystal structure of the complex of type 1 ribosome inactivating protein from momordica balsamina with uridine at 1.97 angstrom resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d5ilwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilwa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d5ilwa_:

Click to download the PDB-style file with coordinates for d5ilwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ilwa_: