SCOPe 2.06: Domain d5hg5a_: 5hg5 A:

Lineage for d5hg5a_ (5hg5 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
   PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82796] (90 PDB entries)
   Uniprot P00533 702-1018

8. Domain d5hg5a_: 5hg5 A: [314724]
   automated match to d3ikaa_

Details for d5hg5a_

PDB Entry: 5hg5

PDB Description: egfr (l858r, t790m, v948r) in complex with n-{3-[(2-{[4-(4- methylpiperazin-1-yl)phenyl]amino}-7h-pyrrolo[2,3-d]pyrimidin-4-yl) oxy]phenyl}prop-2-enamide

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5hg5a_:

Sequence; same for both SEQRES and ATOM records:

>d5hg5a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkvpik
wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic
tidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyr
al

Timeline for d5hg5a_:

• d5hg5a_ is new in SCOPe 2.06-stable
  
• d5hg5a_ appears in SCOPe 2.07
  
• d5hg5a_ appears in the current release, SCOPe 2.08