SCOP 1.61: Domain d1ggja1: 1ggj A:598-753

Lineage for d1ggja1 (1ggj A:598-753)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (1 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (9 PDB entries)

8. Domain d1ggja1: 1ggj A:598-753 [31457]
   Other proteins in same PDB: d1ggja2, d1ggjb2, d1ggjc2, d1ggjd2

Details for d1ggja1

PDB Entry: 1ggj, 1.92 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, asn201ala variant.

SCOP Domain Sequences for d1ggja1:

Sequence; same for both SEQRES and ATOM records:

>d1ggja1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d1ggja1:

• d1ggja1 first appeared (with stable ids) in SCOP 1.55
  
• d1ggja1 appears in SCOP 1.59
  
• d1ggja1 appears in SCOP 1.63
  
• d1ggja1 appears in the current release, SCOPe 2.08