Lineage for d1ggeb1 (1gge B:598-753)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589414Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 1589415Protein Catalase, C-terminal domain [52329] (2 species)
  7. 1589416Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)
  8. 1589434Domain d1ggeb1: 1gge B:598-753 [31450]
    Other proteins in same PDB: d1ggea2, d1ggeb2, d1ggec2, d1gged2
    complexed with hdd

Details for d1ggeb1

PDB Entry: 1gge (more details), 1.89 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, native structure at 1.9 a resolution.
PDB Compounds: (B:) protein (catalase hpii)

SCOPe Domain Sequences for d1ggeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggeb1 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d1ggeb1:

Click to download the PDB-style file with coordinates for d1ggeb1.
(The format of our PDB-style files is described here.)

Timeline for d1ggeb1: