SCOP 1.63: Domain d1g2ia_: 1g2i A:

Lineage for d1g2ia_ (1g2i A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.2: Intracellular protease [52325] (1 protein)
   contains a catalytic Cys-His-Glu triad that differs from the class I GAT triad

6. Protein Intracellular protease [52326] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)

8. Domain d1g2ia_: 1g2i A: [31438]

Details for d1g2ia_

PDB Entry: 1g2i, 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

SCOP Domain Sequences for d1g2ia_:

Sequence; same for both SEQRES and ATOM records:

>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

Timeline for d1g2ia_:

• d1g2ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1g2ia_ appears in SCOP 1.61
  
• d1g2ia_ appears in SCOP 1.65
  
• d1g2ia_ appears in the current release, SCOPe 2.08