Lineage for d1bxrd2 (1bxr D:153-380)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241731Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures
  5. 241732Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 241743Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 241744Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)
  8. 241774Domain d1bxrd2: 1bxr D:153-380 [31430]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1

Details for d1bxrd2

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrd2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1bxrd2:

Click to download the PDB-style file with coordinates for d1bxrd2.
(The format of our PDB-style files is described here.)

Timeline for d1bxrd2: