Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries) |
Domain d5fdod1: 5fdo D:172-320 [314083] Other proteins in same PDB: d5fdoa2, d5fdob2, d5fdoc2, d5fdod2 automated match to d2kbwa_ complexed with 5x2 |
PDB Entry: 5fdo (more details), 2.8 Å
SCOPe Domain Sequences for d5fdod1:
Sequence, based on SEQRES records: (download)
>d5fdod1 f.1.4.1 (D:172-320) automated matches {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffh
>d5fdod1 f.1.4.1 (D:172-320) automated matches {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgatsrkaletlrrvgdgvqrnhetafqgmlrkldiknedd vkslsrvmihvfsvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvrtkrd wlvkqrgwdgfveffh
Timeline for d5fdod1: