![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein GMP synthetase [52319] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52320] (1 PDB entry) |
![]() | Domain d1gpmd2: 1gpm D:3-207 [31408] Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3 complexed with amp, cit, mg, po4, pop |
PDB Entry: 1gpm (more details), 2.2 Å
SCOPe Domain Sequences for d1gpmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpmd2 c.23.16.1 (D:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp evthtrqgmrmlerfvrdicqceal
Timeline for d1gpmd2: