SCOPe 2.08: Domain d5eo2c1: 5eo2 C:1-155

Lineage for d5eo2c1 (5eo2 C:1-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)

8. Domain d5eo2c1: 5eo2 C:1-155 [314021]
   Other proteins in same PDB: d5eo2c2, d5eo2f2
   automated match to d5eo4a_
   complexed with coa

Details for d5eo2c1

PDB Entry: 5eo2, 2.5 Å

PDB Description: structural and biochemical characterization of the hypothetical protein sav2348 from staphylococcus aureus in complex with coa.

PDB Compounds: (C:) thioesterase

SCOPe Domain Sequences for d5eo2c1:

Sequence; same for both SEQRES and ATOM records:

>d5eo2c1 d.38.1.0 (C:1-155) automated matches {Staphylococcus aureus [TaxId: 158878]}
mikqlfthtqtvtsefidhnnhmhdanyniifsdvvnrfnyshglslkerenlaytlftl
eehttylselslgdvftvtlyiydydykrlhlfltltkedgtlastnevmmmginqhtrr
sdafpesfstqiahyyknqptitwpeqlghkiaip

Timeline for d5eo2c1:

• d5eo2c1 first appeared in SCOPe 2.06
  
• d5eo2c1 appears in SCOPe 2.07