Lineage for d5eo2e_ (5eo2 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188690Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)
  8. 2188720Domain d5eo2e_: 5eo2 E: [314012]
    Other proteins in same PDB: d5eo2c2, d5eo2f2
    automated match to d5eo4a_
    complexed with coa

Details for d5eo2e_

PDB Entry: 5eo2 (more details), 2.5 Å

PDB Description: structural and biochemical characterization of the hypothetical protein sav2348 from staphylococcus aureus in complex with coa.
PDB Compounds: (E:) thioesterase

SCOPe Domain Sequences for d5eo2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eo2e_ d.38.1.0 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mikqlfthtqtvtsefidhnnhmhdanyniifsdvvnrfnyshglslkerenlaytlftl
eehttylselslgdvftvtlyiydydykrlhlfltltkedgtlastnevmmmginqhtrr
sdafpesfstqiahyyknqptitwpeqlghkiaip

SCOPe Domain Coordinates for d5eo2e_:

Click to download the PDB-style file with coordinates for d5eo2e_.
(The format of our PDB-style files is described here.)

Timeline for d5eo2e_: