![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein automated matches [190161] (29 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187306] (111 PDB entries) |
![]() | Domain d5fa7b_: 5fa7 B: [314006] automated match to d1ylpa_ complexed with 5vr |
PDB Entry: 5fa7 (more details), 1.67 Å
SCOPe Domain Sequences for d5fa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fa7b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} dvqqklaelerqsggrlgvalintadnsqilyraderfamcstskvmaaaavlkksesep nllnqrveikksdlvnynpiaekhvngtmslaelsaaalqysdnvamnkliahvggpasv tafarqlgdetfrldrteptlntaipgdprdttspramaqtlrnltlgkalgdsqraqlv twmkgnttgaasiqaglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpqp kaesrrdvlasaakivtd
Timeline for d5fa7b_: