Lineage for d5f1ud_ (5f1u D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097054Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2097064Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries)
  8. 2097076Domain d5f1ud_: 5f1u D: [313935]
    automated match to d3lera_
    complexed with 3vn, cl, edo, pg4, pge

Details for d5f1ud_

PDB Entry: 5f1u (more details), 2.35 Å

PDB Description: biomimetic design results in a potent allosteric inhibitor of dihydrodipicolinate synthase from campylobacter jejuni
PDB Compounds: (D:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5f1ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1ud_ c.1.10.1 (D:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d5f1ud_:

Click to download the PDB-style file with coordinates for d5f1ud_.
(The format of our PDB-style files is described here.)

Timeline for d5f1ud_: