SCOPe 2.08: Domain d5f1ja2: 5f1j A:95-215

Lineage for d5f1ja2 (5f1j A:95-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d5f1ja2: 5f1j A:95-215 [313904]
   Other proteins in same PDB: d5f1ja1
   automated match to d3q0wa2
   complexed with 5to

Details for d5f1ja2

PDB Entry: 5f1j, 1.63 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 1 at 1.63a resolution

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5f1ja2:

Sequence; same for both SEQRES and ATOM records:

>d5f1ja2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

Timeline for d5f1ja2:

• d5f1ja2 first appeared in SCOPe 2.06
  
• d5f1ja2 appears in SCOPe 2.07