SCOP 1.63: Domain d1d0id_: 1d0i D:

Lineage for d1d0id_ (1d0i D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (3 species)

7. Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)

8. Domain d1d0id_: 1d0i D: [31386]

Details for d1d0id_

PDB Entry: 1d0i, 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions

SCOP Domain Sequences for d1d0id_:

Sequence; same for both SEQRES and ATOM records:

>d1d0id_ c.23.13.1 (D:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalaga

Timeline for d1d0id_:

• d1d0id_ first appeared (with stable ids) in SCOP 1.55
  
• d1d0id_ appears in SCOP 1.61
  
• d1d0id_ appears in SCOP 1.65
  
• d1d0id_ appears in the current release, SCOPe 2.08