SCOP 1.59: Domain d1d4gd2: 1d4g D:2-189,D:353-431

Lineage for d1d4gd2 (1d4g D:2-189,D:353-431)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
Protein S-adenosylhomocystein hydrolase [52301] (2 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (4 PDB entries)
Domain d1d4gd2: 1d4g D:2-189,D:353-431 [31377]
Other proteins in same PDB: d1d4ga1, d1d4gb1, d1d4gc1, d1d4gd1, d1d4ge1, d1d4gf1, d1d4gg1, d1d4gh1

Details for d1d4gd2

PDB Description: crystal structure of s-adenosylhomocysteine hydrolase (adohcyase) complexed with a potent inhibitor d-eritadenine

SCOP Domain Sequences for d1d4gd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4gd2 c.23.12.3 (D:2-189,D:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1d4gd2:

Click to download the PDB-style file with coordinates for d1d4gd2.
(The format of our PDB-style files is described here.)

Timeline for d1d4gd2: