Lineage for d5dxub_ (5dxu B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2268037Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2268220Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 2268221Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 2268225Protein automated matches [310859] (2 species)
    not a true protein
  7. 2268226Species Cow (Bos taurus) [TaxId:9913] [311310] (4 PDB entries)
  8. 2268229Domain d5dxub_: 5dxu B: [313464]
    automated match to d2v1yb_
    complexed with 5h5

Details for d5dxub_

PDB Entry: 5dxu (more details), 2.64 Å

PDB Description: p110delta/p85alpha with gdc-0326
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d5dxub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dxub_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d5dxub_:

Click to download the PDB-style file with coordinates for d5dxub_.
(The format of our PDB-style files is described here.)

Timeline for d5dxub_: