Lineage for d1bwpa_ (1bwp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465653Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 2465654Protein Platelet-activating factor acetylhydrolase [52274] (2 species)
  7. 2465655Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries)
  8. 2465658Domain d1bwpa_: 1bwp A: [31342]

Details for d1bwpa_

PDB Entry: 1bwp (more details), 2.1 Å

PDB Description: probing the substrate specificity of the intracellular brain platelet- activating factor acetylhydrolase
PDB Compounds: (A:) platelet-activating factor acetylhydrolase

SCOPe Domain Sequences for d1bwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwpa_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdsavqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll

SCOPe Domain Coordinates for d1bwpa_:

Click to download the PDB-style file with coordinates for d1bwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bwpa_: