SCOPe 2.06: Domain d5diva_: 5div A:

Lineage for d5diva_ (5div A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (44 PDB entries)

8. Domain d5diva_: 5div A: [313369]
   automated match to d4drha_

Details for d5diva_

PDB Entry: 5div

PDB Description: the fk1 domain of fkbp51 in complex with the new synthetic ligand (s)- n-(1-carbamoylcyclopentyl)-1-((s)-2-cyclohexyl-2-(3,4,5- trimethoxyphenyl)acetyl)piperidine-2-carboxamide

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d5diva_:

Sequence; same for both SEQRES and ATOM records:

>d5diva_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkg

Timeline for d5diva_:

• d5diva_ is new in SCOPe 2.06-stable
  
• d5diva_ is called d5diva1 in SCOPe 2.07
  
• d5diva_ appears in the current release, SCOPe 2.08, called d5diva1