Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Oceanimonas doudoroffii [TaxId:84158] [312434] (1 PDB entry) |
Domain d4zz7i_: 4zz7 I: [313049] automated match to d4iyma_ complexed with nad |
PDB Entry: 4zz7 (more details), 2.9 Å
SCOPe Domain Sequences for d4zz7i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zz7i_ c.82.1.0 (I:) automated matches {Oceanimonas doudoroffii [TaxId: 84158]} mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr wpsagvre
Timeline for d4zz7i_: