Lineage for d1xzb__ (1xzb -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241434Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 241435Family c.23.9.1: Cutinase-like [52260] (2 proteins)
    this family can be also classified into alpha/beta hydrolase superfamily
  6. 241444Protein Cutinase [52261] (1 species)
  7. 241445Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 241463Domain d1xzb__: 1xzb - [31303]
    complexed with mac; mutant

Details for d1xzb__

PDB Entry: 1xzb (more details), 1.75 Å

PDB Description: fusarium solani cutinase mutant with ser 129 replaced by cys complex with mercury acetate

SCOP Domain Sequences for d1xzb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzb__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaaciedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

SCOP Domain Coordinates for d1xzb__:

Click to download the PDB-style file with coordinates for d1xzb__.
(The format of our PDB-style files is described here.)

Timeline for d1xzb__: