SCOP 1.63: Domain d1xzb__: 1xzb -

Lineage for d1xzb__ (1xzb -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.9: Cutinase-like [52259] (1 family)

5. Family c.23.9.1: Cutinase-like [52260] (2 proteins)
   this family can be also classified into alpha/beta hydrolase superfamily

6. Protein Cutinase [52261] (1 species)

7. Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)

8. Domain d1xzb__: 1xzb - [31303]
   complexed with mac; mutant

Details for d1xzb__

PDB Entry: 1xzb, 1.75 Å

PDB Description: fusarium solani cutinase mutant with ser 129 replaced by cys complex with mercury acetate

SCOP Domain Sequences for d1xzb__:

Sequence; same for both SEQRES and ATOM records:

>d1xzb__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaaciedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

Timeline for d1xzb__:

• d1xzb__ first appeared (with stable ids) in SCOP 1.55
  
• d1xzb__ appears in SCOP 1.61
  
• d1xzb__ appears in SCOP 1.65
  
• d1xzb__ appears in the current release, SCOPe 2.08, called d1xzba_