SCOPe 2.08: Domain d5cz2e_: 5cz2 E:

Lineage for d5cz2e_ (5cz2 E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Mouse mammary tumor virus (strain br6) [TaxId:11758] [312889] (1 PDB entry)

8. Domain d5cz2e_: 5cz2 E: [312916]
   automated match to d3l3ua_
   complexed with mg, zn

Details for d5cz2e_

PDB Entry: 5cz2, 2.72 Å

PDB Description: crystal structure of a two-domain fragment of mmtv integrase

PDB Compounds: (E:) Pol polyprotein

SCOPe Domain Sequences for d5cz2e_:

Sequence, based on SEQRES records:

>d5cz2e_ c.55.3.0 (E:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]}
vnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsf
aymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnk
lqkagkyytphhllahalfvlnhvnmdnqghtaaerhwg

Sequence, based on observed residues (ATOM records):

>d5cz2e_ c.55.3.0 (E:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]}
vnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsf
aymgipqkiktdnapayvsrsiqeflarwkishvtgiqaiverthqnikaqlnklqkagk
yytphhllahalfvlnhvnmdnqghtaaerhwg

Timeline for d5cz2e_:

• d5cz2e_ first appeared in SCOPe 2.06
  
• d5cz2e_ appears in SCOPe 2.07