Lineage for d1ffd__ (1ffd -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241434Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 241435Family c.23.9.1: Cutinase-like [52260] (2 proteins)
    this family can be also classified into alpha/beta hydrolase superfamily
  6. 241444Protein Cutinase [52261] (1 species)
  7. 241445Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 241451Domain d1ffd__: 1ffd - [31290]
    mutant

Details for d1ffd__

PDB Entry: 1ffd (more details), 1.69 Å

PDB Description: contribution of cutinase serine 42 side chain to the stabilization of the oxyanion transition state

SCOP Domain Sequences for d1ffd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffd__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdwalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

SCOP Domain Coordinates for d1ffd__:

Click to download the PDB-style file with coordinates for d1ffd__.
(The format of our PDB-style files is described here.)

Timeline for d1ffd__: