Lineage for d1c4ka1 (1c4k A:1-107)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115071Family c.23.1.4: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein)
    automatically mapped to Pfam PF03709
  6. 2115072Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species)
  7. 2115073Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries)
  8. 2115074Domain d1c4ka1: 1c4k A:1-107 [31273]
    Other proteins in same PDB: d1c4ka2, d1c4ka3
    complexed with gtp, plp; mutant

Details for d1c4ka1

PDB Entry: 1c4k (more details), 2.7 Å

PDB Description: ornithine decarboxylase mutant (gly121tyr)
PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d1c4ka1:

Sequence, based on SEQRES records: (download)

>d1c4ka1 c.23.1.4 (A:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil

Sequence, based on observed residues (ATOM records): (download)

>d1c4ka1 c.23.1.4 (A:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlefdatvnareietavnnyedsil

SCOPe Domain Coordinates for d1c4ka1:

Click to download the PDB-style file with coordinates for d1c4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1c4ka1: