Lineage for d4z8sb2 (4z8s B:133-261)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792306Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2792307Protein automated matches [226913] (9 species)
    not a true protein
  7. 2792308Species Bitter gourd (Momordica charantia) [TaxId:3673] [312303] (9 PDB entries)
  8. 2792318Domain d4z8sb2: 4z8s B:133-261 [312726]
    Other proteins in same PDB: d4z8sa_
    automated match to d4hr6c2
    complexed with gol, nag

Details for d4z8sb2

PDB Entry: 4z8s (more details), 2.36 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd)-native-1
PDB Compounds: (B:) rRNA N-glycosidase

SCOPe Domain Sequences for d4z8sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z8sb2 b.42.2.0 (B:133-261) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
yvepivttiiglrhmcleatdndtnvwlescvknktkqywalysddtirvnnnrnlcvss
stdsssklivirrcdgsinqrwvftpqgtisnpgyeavmdvaqndvylkkivlssatdkg
ngqqwtvfy

SCOPe Domain Coordinates for d4z8sb2:

Click to download the PDB-style file with coordinates for d4z8sb2.
(The format of our PDB-style files is described here.)

Timeline for d4z8sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z8sb1
View in 3D
Domains from other chains:
(mouse over for more information)
d4z8sa_