Lineage for d3reqa2 (3req A:561-728)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116201Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2116202Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 2116227Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
    active subunit; binds B12
  7. 2116228Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
  8. 2116243Domain d3reqa2: 3req A:561-728 [31271]
    Other proteins in same PDB: d3reqa1, d3reqb1, d3reqb2
    complexed with adn, b12

Details for d3reqa2

PDB Entry: 3req (more details), 2.7 Å

PDB Description: methylmalonyl-coa mutase, substrate-free state (poor quality structure)
PDB Compounds: (A:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d3reqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d3reqa2:

Click to download the PDB-style file with coordinates for d3reqa2.
(The format of our PDB-style files is described here.)

Timeline for d3reqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3reqa1