|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain | 
|  | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)  precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function | 
|  | Family c.30.1.0: automated matches [227183] (1 protein) not a true family | 
|  | Protein automated matches [226903] (40 species) not a true protein | 
|  | Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries) | 
|  | Domain d5c1pa1: 5c1p A:1-96 [312701] Other proteins in same PDB: d5c1pa2, d5c1pb2, d5c1pc2, d5c1pd2 automated match to d1iowa1 complexed with act, adp, dal, gol, na | 
PDB Entry: 5c1p (more details), 2.4 Å
SCOPe Domain Sequences for d5c1pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c1pa1 c.30.1.0 (A:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd
Timeline for d5c1pa1: