Lineage for d5c1pa1 (5c1p A:1-96)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862557Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries)
  8. 2862570Domain d5c1pa1: 5c1p A:1-96 [312701]
    Other proteins in same PDB: d5c1pa2, d5c1pb2, d5c1pc2, d5c1pd2
    automated match to d1iowa1
    complexed with act, adp, dal, gol, na

Details for d5c1pa1

PDB Entry: 5c1p (more details), 2.4 Å

PDB Description: crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d- alanine ligase(ddl) from yersinia pestis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c1pa1 c.30.1.0 (A:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd

SCOPe Domain Coordinates for d5c1pa1:

Click to download the PDB-style file with coordinates for d5c1pa1.
(The format of our PDB-style files is described here.)

Timeline for d5c1pa1: