SCOPe 2.08: Domain d5c1pb1: 5c1p B:1-96

Lineage for d5c1pb1 (5c1p B:1-96)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries)

8. Domain d5c1pb1: 5c1p B:1-96 [312691]
   Other proteins in same PDB: d5c1pa2, d5c1pb2, d5c1pc2, d5c1pd2
   automated match to d1iowa1
   complexed with act, adp, dal, gol, na

Details for d5c1pb1

PDB Entry: 5c1p, 2.4 Å

PDB Description: crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d- alanine ligase(ddl) from yersinia pestis

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1pb1:

Sequence; same for both SEQRES and ATOM records:

>d5c1pb1 c.30.1.0 (B:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd

Timeline for d5c1pb1:

• d5c1pb1 first appeared in SCOPe 2.06
  
• d5c1pb1 appears in SCOPe 2.07