SCOPe 2.08: Domain d5c1ob1: 5c1o B:1-96

Lineage for d5c1ob1 (5c1o B:1-96)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries)

8. Domain d5c1ob1: 5c1o B:1-96 [312662]
   Other proteins in same PDB: d5c1oa2, d5c1ob2, d5c1oc2, d5c1od2
   automated match to d1iowa1
   complexed with anp, mg, na

Details for d5c1ob1

PDB Entry: 5c1o, 2.5 Å

PDB Description: crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1ob1:

Sequence; same for both SEQRES and ATOM records:

>d5c1ob1 c.30.1.0 (B:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd

Timeline for d5c1ob1:

• d5c1ob1 first appeared in SCOPe 2.06
  
• d5c1ob1 appears in SCOPe 2.07