Lineage for d5c1od2 (5c1o D:97-306)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979280Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries)
  8. 2979300Domain d5c1od2: 5c1o D:97-306 [312678]
    Other proteins in same PDB: d5c1oa1, d5c1ob1, d5c1oc1, d5c1od1
    automated match to d1iova2
    complexed with anp, mg, na

Details for d5c1od2

PDB Entry: 5c1o (more details), 2.5 Å

PDB Description: crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1od2:

Sequence, based on SEQRES records: (download)

>d5c1od2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records): (download)

>d5c1od2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshesvgmskvd
haselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfdktqyfcps
glsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaa
rqyglsfsqlvarilmlad

SCOPe Domain Coordinates for d5c1od2:

Click to download the PDB-style file with coordinates for d5c1od2.
(The format of our PDB-style files is described here.)

Timeline for d5c1od2: